SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F3UWG0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0F3UWG0
Domain Number - Region: 39-129
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.000863
Family SMI1/KNR4-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0F3UWG0
Sequence length 145
Comment (tr|A0A0F3UWG0|A0A0F3UWG0_ECOLX) Uncharacterized protein {ECO:0000313|EMBL:KXL70107.1} KW=Complete proteome OX=562 OS=Escherichia coli. GN=AML07_09025 OC=Enterobacteriaceae; Escherichia.
Sequence
MCELINEASKYGKVNERKMDIDLCCKKIEEEGYSVFVAFYDFIKKYGGLYGFHSAYKDTT
INEAFFIDPERASNRIFIERVNDYIERAGYNMIPVGECSNGHITLLYGENNVIYGGLDDY
LWKYGDNLSSSIDILINGKEAVEIP
Download sequence
Identical sequences A0A027T5I6 A0A027ZDB0 A0A028DL32 A0A0A8U4F3 A0A0F3UWG0 I2UKB5 K4XFX3 V8FPQ7 W1V4C5
WP_000333355.1.100066 WP_000333355.1.100425 WP_000333355.1.100543 WP_000333355.1.100667 WP_000333355.1.100836 WP_000333355.1.101157 WP_000333355.1.101216 WP_000333355.1.101436 WP_000333355.1.101468 WP_000333355.1.10154 WP_000333355.1.101630 WP_000333355.1.101653 WP_000333355.1.101668 WP_000333355.1.101786 WP_000333355.1.101840 WP_000333355.1.101865 WP_000333355.1.101913 WP_000333355.1.101952 WP_000333355.1.102069 WP_000333355.1.102122 WP_000333355.1.10461 WP_000333355.1.10538 WP_000333355.1.10579 WP_000333355.1.10607 WP_000333355.1.10763 WP_000333355.1.10798 WP_000333355.1.11524 WP_000333355.1.11616 WP_000333355.1.11759 WP_000333355.1.11949 WP_000333355.1.12566 WP_000333355.1.12645 WP_000333355.1.12743 WP_000333355.1.1295 WP_000333355.1.13222 WP_000333355.1.14058 WP_000333355.1.14062 WP_000333355.1.14493 WP_000333355.1.14693 WP_000333355.1.15138 WP_000333355.1.1524 WP_000333355.1.15528 WP_000333355.1.15593 WP_000333355.1.1582 WP_000333355.1.16194 WP_000333355.1.1640 WP_000333355.1.16517 WP_000333355.1.16805 WP_000333355.1.17242 WP_000333355.1.17464 WP_000333355.1.17623 WP_000333355.1.17637 WP_000333355.1.1766 WP_000333355.1.17961 WP_000333355.1.17963 WP_000333355.1.18438 WP_000333355.1.18458 WP_000333355.1.1906 WP_000333355.1.19332 WP_000333355.1.19424 WP_000333355.1.19494 WP_000333355.1.19583 WP_000333355.1.20334 WP_000333355.1.20519 WP_000333355.1.20730 WP_000333355.1.21041 WP_000333355.1.21104 WP_000333355.1.21137 WP_000333355.1.21667 WP_000333355.1.21732 WP_000333355.1.22291 WP_000333355.1.22544 WP_000333355.1.22649 WP_000333355.1.22868 WP_000333355.1.23005 WP_000333355.1.23078 WP_000333355.1.23092 WP_000333355.1.23487 WP_000333355.1.23527 WP_000333355.1.23693 WP_000333355.1.23741 WP_000333355.1.23754 WP_000333355.1.24024 WP_000333355.1.24136 WP_000333355.1.24381 WP_000333355.1.24460 WP_000333355.1.24646 WP_000333355.1.25019 WP_000333355.1.25378 WP_000333355.1.25592 WP_000333355.1.25613 WP_000333355.1.25886 WP_000333355.1.26055 WP_000333355.1.26186 WP_000333355.1.27148 WP_000333355.1.2731 WP_000333355.1.27424 WP_000333355.1.27897 WP_000333355.1.28110 WP_000333355.1.2881 WP_000333355.1.29082 WP_000333355.1.29202 WP_000333355.1.29504 WP_000333355.1.29669 WP_000333355.1.29798 WP_000333355.1.29876 WP_000333355.1.30035 WP_000333355.1.31319 WP_000333355.1.31340 WP_000333355.1.31357 WP_000333355.1.31429 WP_000333355.1.31860 WP_000333355.1.31866 WP_000333355.1.32142 WP_000333355.1.32287 WP_000333355.1.3247 WP_000333355.1.32475 WP_000333355.1.32709 WP_000333355.1.32831 WP_000333355.1.32995 WP_000333355.1.3354 WP_000333355.1.33680 WP_000333355.1.33914 WP_000333355.1.3539 WP_000333355.1.35653 WP_000333355.1.35927 WP_000333355.1.36070 WP_000333355.1.36166 WP_000333355.1.36177 WP_000333355.1.37046 WP_000333355.1.37476 WP_000333355.1.37510 WP_000333355.1.377 WP_000333355.1.3772 WP_000333355.1.37773 WP_000333355.1.37887 WP_000333355.1.37917 WP_000333355.1.37995 WP_000333355.1.38033 WP_000333355.1.38103 WP_000333355.1.38120 WP_000333355.1.38257 WP_000333355.1.38412 WP_000333355.1.38626 WP_000333355.1.39005 WP_000333355.1.39103 WP_000333355.1.39123 WP_000333355.1.3970 WP_000333355.1.40206 WP_000333355.1.40249 WP_000333355.1.40382 WP_000333355.1.40403 WP_000333355.1.4049 WP_000333355.1.41125 WP_000333355.1.41147 WP_000333355.1.41263 WP_000333355.1.41392 WP_000333355.1.41407 WP_000333355.1.4142 WP_000333355.1.41455 WP_000333355.1.41466 WP_000333355.1.41613 WP_000333355.1.42027 WP_000333355.1.42038 WP_000333355.1.42138 WP_000333355.1.42203 WP_000333355.1.42252 WP_000333355.1.42318 WP_000333355.1.42387 WP_000333355.1.42442 WP_000333355.1.42748 WP_000333355.1.42832 WP_000333355.1.4290 WP_000333355.1.43166 WP_000333355.1.43316 WP_000333355.1.43363 WP_000333355.1.4342 WP_000333355.1.44018 WP_000333355.1.44077 WP_000333355.1.4415 WP_000333355.1.45868 WP_000333355.1.45960 WP_000333355.1.45968 WP_000333355.1.46081 WP_000333355.1.46197 WP_000333355.1.46555 WP_000333355.1.46668 WP_000333355.1.47034 WP_000333355.1.47473 WP_000333355.1.47820 WP_000333355.1.48144 WP_000333355.1.48433 WP_000333355.1.48801 WP_000333355.1.48954 WP_000333355.1.49107 WP_000333355.1.49229 WP_000333355.1.49336 WP_000333355.1.49712 WP_000333355.1.49856 WP_000333355.1.49950 WP_000333355.1.50119 WP_000333355.1.50182 WP_000333355.1.50258 WP_000333355.1.50361 WP_000333355.1.50996 WP_000333355.1.51175 WP_000333355.1.51260 WP_000333355.1.51278 WP_000333355.1.51299 WP_000333355.1.51537 WP_000333355.1.52171 WP_000333355.1.52272 WP_000333355.1.52777 WP_000333355.1.5310 WP_000333355.1.53251 WP_000333355.1.53401 WP_000333355.1.53537 WP_000333355.1.53866 WP_000333355.1.54091 WP_000333355.1.54307 WP_000333355.1.54591 WP_000333355.1.54695 WP_000333355.1.55115 WP_000333355.1.5520 WP_000333355.1.55338 WP_000333355.1.55844 WP_000333355.1.55988 WP_000333355.1.5646 WP_000333355.1.56543 WP_000333355.1.56680 WP_000333355.1.5670 WP_000333355.1.56835 WP_000333355.1.57487 WP_000333355.1.57812 WP_000333355.1.58022 WP_000333355.1.58172 WP_000333355.1.58267 WP_000333355.1.58977 WP_000333355.1.58983 WP_000333355.1.59190 WP_000333355.1.59293 WP_000333355.1.59782 WP_000333355.1.60070 WP_000333355.1.6059 WP_000333355.1.60606 WP_000333355.1.60835 WP_000333355.1.6110 WP_000333355.1.61112 WP_000333355.1.61948 WP_000333355.1.61957 WP_000333355.1.62041 WP_000333355.1.62447 WP_000333355.1.62514 WP_000333355.1.62529 WP_000333355.1.62668 WP_000333355.1.62850 WP_000333355.1.62851 WP_000333355.1.6299 WP_000333355.1.63437 WP_000333355.1.63467 WP_000333355.1.63484 WP_000333355.1.63536 WP_000333355.1.64014 WP_000333355.1.64050 WP_000333355.1.64074 WP_000333355.1.64356 WP_000333355.1.64438 WP_000333355.1.65962 WP_000333355.1.66181 WP_000333355.1.66288 WP_000333355.1.66926 WP_000333355.1.67018 WP_000333355.1.67102 WP_000333355.1.6723 WP_000333355.1.67663 WP_000333355.1.68175 WP_000333355.1.682 WP_000333355.1.68255 WP_000333355.1.68300 WP_000333355.1.68609 WP_000333355.1.68751 WP_000333355.1.70628 WP_000333355.1.70748 WP_000333355.1.70801 WP_000333355.1.70967 WP_000333355.1.71113 WP_000333355.1.71134 WP_000333355.1.71275 WP_000333355.1.71537 WP_000333355.1.71874 WP_000333355.1.72013 WP_000333355.1.72270 WP_000333355.1.72493 WP_000333355.1.7277 WP_000333355.1.72858 WP_000333355.1.73032 WP_000333355.1.73075 WP_000333355.1.73326 WP_000333355.1.73468 WP_000333355.1.73663 WP_000333355.1.73709 WP_000333355.1.73797 WP_000333355.1.74431 WP_000333355.1.74478 WP_000333355.1.74752 WP_000333355.1.74885 WP_000333355.1.75588 WP_000333355.1.75676 WP_000333355.1.76542 WP_000333355.1.76966 WP_000333355.1.77022 WP_000333355.1.77109 WP_000333355.1.77477 WP_000333355.1.77608 WP_000333355.1.77626 WP_000333355.1.77767 WP_000333355.1.78698 WP_000333355.1.78757 WP_000333355.1.78775 WP_000333355.1.78843 WP_000333355.1.79606 WP_000333355.1.79824 WP_000333355.1.80141 WP_000333355.1.80484 WP_000333355.1.80709 WP_000333355.1.80754 WP_000333355.1.80945 WP_000333355.1.80946 WP_000333355.1.810 WP_000333355.1.81316 WP_000333355.1.81376 WP_000333355.1.81517 WP_000333355.1.81972 WP_000333355.1.82 WP_000333355.1.82242 WP_000333355.1.82246 WP_000333355.1.82572 WP_000333355.1.83684 WP_000333355.1.84140 WP_000333355.1.84656 WP_000333355.1.84784 WP_000333355.1.84881 WP_000333355.1.84893 WP_000333355.1.84941 WP_000333355.1.85762 WP_000333355.1.85944 WP_000333355.1.86451 WP_000333355.1.87075 WP_000333355.1.88535 WP_000333355.1.88631 WP_000333355.1.88883 WP_000333355.1.89067 WP_000333355.1.89479 WP_000333355.1.89818 WP_000333355.1.89839 WP_000333355.1.90626 WP_000333355.1.90856 WP_000333355.1.90864 WP_000333355.1.90873 WP_000333355.1.91266 WP_000333355.1.91565 WP_000333355.1.91959 WP_000333355.1.91971 WP_000333355.1.92048 WP_000333355.1.921 WP_000333355.1.92434 WP_000333355.1.9255 WP_000333355.1.92780 WP_000333355.1.93338 WP_000333355.1.94232 WP_000333355.1.94317 WP_000333355.1.94468 WP_000333355.1.94507 WP_000333355.1.9513 WP_000333355.1.95161 WP_000333355.1.95243 WP_000333355.1.95563 WP_000333355.1.95655 WP_000333355.1.96247 WP_000333355.1.96817 WP_000333355.1.97344 WP_000333355.1.97361 WP_000333355.1.97434 WP_000333355.1.97544 WP_000333355.1.9816 WP_000333355.1.98232 WP_000333355.1.98357 WP_000333355.1.98549 WP_000333355.1.98665 WP_000333355.1.99246 WP_000333355.1.99475 WP_000333355.1.99511 WP_000333355.1.99869

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]