SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F4BKT4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F4BKT4
Domain Number 1 Region: 58-162
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000106
Family SMI1/KNR4-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0F4BKT4
Sequence length 165
Comment (tr|A0A0F4BKT4|A0A0F4BKT4_9ENTR) Uncharacterized protein {ECO:0000313|EMBL:KJX35190.1} KW=Complete proteome OX=1870932 OS=Enterobacter cloacae complex sp. CIDEIMsCOL9. GN=SG71_15210 OC=Enterobacteriaceae; Enterobacter; Enterobacter cloacae complex.
Sequence
MMVNELSKLMEDNGYRIFPPVSINFLESMTKANSSSTDLPPVLEDINTDILFFLKTQPDY
YYFLTKMDGFEFDGVILYSFALQLEEHNVPVNNIFLYNDNFRNNDIFVNTDLSERVVIGQ
DSISFFTYDLKENVYQIRDNVGTEKIFGSFDNFSDFLREILETVA
Download sequence
Identical sequences A0A0F4BKT4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]