SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F4GB37 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F4GB37
Domain Number 1 Region: 14-59,181-263
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 3.27e-22
Family Regulator of G-protein signaling, RGS 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0F4GB37
Sequence length 377
Comment (tr|A0A0F4GB37|A0A0F4GB37_9PEZI) Rgs domain protein {ECO:0000313|EMBL:KJX94601.1} KW=Complete proteome; Reference proteome OX=1047168 OS=Zymoseptoria brevis. GN=TI39_contig4173g00037 OC=Zymoseptoria.
Sequence
MESRTPTPEPGLRMRLPNLWEVLSRRTLAPVDLFSFYIYMRDVQRSVDYLDFWLDVSQHM
SLCRHYVRELRRSVLVSTPDLEKSGSKRSSQILDNYNNDRRSSEQGPSGLYTDAKERQTP
DQRLSAFLRNDNGSHHSPQHSQGSTHHSENTPGAEHQPRPSFMTNNSGSPNVNNSNNSPQ
NTVARADIRASAEKILYTFLLPGAEREIILPQGILNDITNSIETEGRDDPEVFDAAKDYV
FQAMERDAFPGFLRAKALGNIVQPSVMLRLIVGLVSFFGALWAAFVLIFLDKNRATRCWL
ILPFTVGIYFLGSHQYMLDPILALLGYSEYTFMNFARIKEPFVRKLLNKRALMCLAGMLI
LDVALLCLFIFVPGKRL
Download sequence
Identical sequences A0A0F4GB37

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]