SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F4GLB1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F4GLB1
Domain Number 1 Region: 22-166
Classification Level Classification E-value
Superfamily GINS helical bundle-like 1.46e-42
Family SLD5 N-terminal domain-like 0.0013
Further Details:      
 
Domain Number 2 Region: 171-221
Classification Level Classification E-value
Superfamily PriA/YqbF domain 0.000000118
Family SLD5 C-terminal domain-like 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0F4GLB1
Sequence length 221
Comment (tr|A0A0F4GLB1|A0A0F4GLB1_9PEZI) DNA replication complex GINS protein SLD5 {ECO:0000256|PIRNR:PIRNR007764} KW=Complete proteome; Reference proteome OX=1047168 OS=Zymoseptoria brevis. GN=TI39_contig429g00016 OC=Zymoseptoria.
Sequence
MDLDISDILASVSAPSIPQKTLDLQALTRAWINERSSPELLPYPTELMQRAMDGVKNQIE
IIESMTGAMDPTANFTLIILQTELERVKFLLRSYLRARIAKIDKHPLHYRSLAVSSAPDR
PLLSTLETQYLASHQALLASHYHSSFLSLFPANLQRLDDTGGGVSMVDKPDEDTAVFCRV
LRDGFAQRPADDDIELKRGDIWVLRWSAIKDSVWNGDVELI
Download sequence
Identical sequences A0A0F4GLB1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]