SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F4GS31 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F4GS31
Domain Number 1 Region: 83-200
Classification Level Classification E-value
Superfamily Peptidyl-tRNA hydrolase II 1.92e-40
Family Peptidyl-tRNA hydrolase II 0.0000408
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0F4GS31
Sequence length 200
Comment (tr|A0A0F4GS31|A0A0F4GS31_9PEZI) Peptidyl-tRNA hydrolase like protein {ECO:0000313|EMBL:KJY00034.1} KW=Complete proteome; Reference proteome OX=1047168 OS=Zymoseptoria brevis. GN=TI39_contig345g00005 OC=Zymoseptoria.
Sequence
MANVQDRGPPSAAAIAIGTGIIAGLTGYFLGQARSIGVFGRSHSASATSGAADDDSELSD
ADEDETSPDDLGELKSFAGNNEECKLVLAVRSDLGMTKGKACAQCGHATLACYKALFRAD
PQNLVLRQWERLGQAKVALRVNSEDELLMLQAQAVSLGVCAQVVHDAGRTQIASGSATVV
GIGPAPKSVVDQITGHLKLL
Download sequence
Identical sequences A0A0F4GS31

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]