SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F4GU86 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F4GU86
Domain Number 1 Region: 21-183
Classification Level Classification E-value
Superfamily Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 1.2e-25
Family Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 0.00035
Further Details:      
 
Domain Number 2 Region: 301-346,377-496
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00000000000131
Family Pseudo ankyrin repeat 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0F4GU86
Sequence length 580
Comment (tr|A0A0F4GU86|A0A0F4GU86_9PEZI) Phosphopentothenoylcysteine decarboxylase like protein {ECO:0000313|EMBL:KJY00985.1} KW=Complete proteome; Reference proteome OX=1047168 OS=Zymoseptoria brevis. GN=TI39_contig306g00009 OC=Zymoseptoria.
Sequence
MAESPPPPDDLLPRSDMHKSREMNIVFVSTGCADSRIVSNLLPRIAMLPDVSVRAVLDTA
FRGQDFIRASSSCLTMPNATRRCSVRDIAEIEQEAAELCEWANLLVLAPIDANNLAKMLH
GQTDNLLLELLRGWDVSKKILLLPGMSSAMWENPMTKKQLTKIRRKWNWVQVLQPMLWNS
VKDEKKLVSWEATSELVDAIRNQVDLMNIGSGLQLSPSMRYAFSHTGNGATSRLPDELWT
MIFDYTNDWELAQTLHIFTNIQPPSEWASHVTPQGPSNYMEALELTILRGQLSDVKHFIA
THSVPRWLSKLCIRLIMRFAMTPLLAHLEAAHKDLFWATFGHTFLPDKASSIFGATEILE
FWRTSPSFLTKEYNVEALDGASRAGFVHVLEWWQHSGLPLKFTEAALEQASSQGHIAVLE
WWRSQSTSQDDSKSTVADSSKVRLKPGKSICYATQNGHTDVVRWWLSSGIAFPHEDTVAK
LASTHGHVDILSAWHEAKGSKMIFDNQVLVGATKSGNVSVLEWWRRSGLKVEYKTCDVEE
ALEDGDEGLRGMEVRKWWARNGLNLGVGTSEWMKTKVLNG
Download sequence
Identical sequences A0A0F4GU86

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]