SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F4ID95 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F4ID95
Domain Number 1 Region: 9-168
Classification Level Classification E-value
Superfamily N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) 8.37e-66
Family N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) 0.00000328
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0F4ID95
Sequence length 178
Comment (tr|A0A0F4ID95|A0A0F4ID95_9ACTN) 5-(carboxyamino)imidazole ribonucleotide mutase {ECO:0000256|HAMAP-Rule:MF_01929} KW=Complete proteome OX=1609135 OS=Streptomyces sp. NRRL S-104. GN=VR43_17830 OC=Streptomyces.
Sequence
MSTTAAGPVIGIVMGSDSDWPVMEAAAQALDEFEIPYEVDVVSAHRMPREMIEYGERAAG
RGLKAIIAGAGGAAHLPGMLASVTPLPVIGVPVPLKYLDGMDSLLSIVQMPAGVPVATVS
VAGARNAGLLAVRMLAAHDTELLARMREFQQELNDQATEKGKRLRTKVANAESFGFGK
Download sequence
Identical sequences A0A0F4ID95 A0A0M8UQJ2
WP_030659829.1.14918 WP_030659829.1.18142 WP_030659829.1.18344 WP_030659829.1.29251 WP_030659829.1.32085 WP_030659829.1.34562 WP_030659829.1.40611 WP_030659829.1.41629 WP_030659829.1.41852 WP_030659829.1.52307 WP_030659829.1.56349 WP_030659829.1.6774 WP_030659829.1.71544 WP_030659829.1.78398 WP_030659829.1.81925 WP_030659829.1.89709 WP_030659829.1.98525

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]