SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F4IFX3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F4IFX3
Domain Number 1 Region: 78-219
Classification Level Classification E-value
Superfamily Sortase 0.00000000000000255
Family Sortase 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0F4IFX3
Sequence length 223
Comment (tr|A0A0F4IFX3|A0A0F4IFX3_9ACTN) Sortase {ECO:0000313|EMBL:KJY20569.1} KW=Complete proteome OX=1609135 OS=Streptomyces sp. NRRL S-104. GN=VR43_15035 OC=Streptomyces.
Sequence
MAAAALAALLLAGCGGQNAAKPPAPAGQAGQGGAPGAASPAGKPAGGDAATSADGSQNGT
GAGAGAGRAEQALARSEPQKITIPSLGLTSTLETLRQNADGTMQTPKDPALAGWYEPGPT
PGSQGPAVIAGHVTWNGASAVFEKLKTMKGGDTIKVTRKDGKTVTFTVDRVGEYPKAEFP
TLEVYKNLDHAGLRLVTCGGDFDPKKHYYDSNVVVFARMTGAA
Download sequence
Identical sequences A0A0F4IFX3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]