SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F4IQJ4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F4IQJ4
Domain Number 1 Region: 44-140
Classification Level Classification E-value
Superfamily gamma-Crystallin-like 0.00000671
Family Crystallins/Ca-binding development proteins 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0F4IQJ4
Sequence length 141
Comment (tr|A0A0F4IQJ4|A0A0F4IQJ4_9ACTN) Uncharacterized protein {ECO:0000313|EMBL:KJY23763.1} KW=Complete proteome; Reference proteome OX=68223 OS=Streptomyces katrae. GN=VR44_37335 OC=Streptomyces.
Sequence
MRRKTARFAVSAATVAGLVMTAATSADASVLLGIGQGAGACPGSHVCLWSENDFVGATSG
SKFGAIASNQNVGDLGKLQRDGALWTGMQDITSSVVNNTGNAICFYEHNNYGGLQFRIGP
WEKWPSVPSWINDRISSFKYC
Download sequence
Identical sequences A0A0F4IQJ4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]