SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F4J4W0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F4J4W0
Domain Number 1 Region: 17-154
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000000262
Family SMI1/KNR4-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0F4J4W0
Sequence length 180
Comment (tr|A0A0F4J4W0|A0A0F4J4W0_9ACTN) Uncharacterized protein {ECO:0000313|EMBL:KJY29290.1} KW=Complete proteome; Reference proteome OX=1609133 OS=Streptomyces sp. NRRL S-495. GN=VR45_30345 OC=Streptomyces.
Sequence
MSVTESWSRVMSLLREHAPADHADLPGPATEQMLTAAEERMGISLQGDLRTWLLQNNLDL
PEEDVDDDVMCCGFDGFPDEGSFLLGIRAMERLYANHPLSGGSEWREEWIPFLSDRDGWT
GKFIDARDGRIGRWFVGAPTVTGEYASLAHYFDSVAEMLTRIGAGDYPVCSVAEGRLVWS
Download sequence
Identical sequences A0A0F4J4W0
WP_045943074.1.21955

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]