SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F4JNR3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F4JNR3
Domain Number 1 Region: 96-322
Classification Level Classification E-value
Superfamily PHP domain-like 2.49e-42
Family PHP domain 0.0013
Further Details:      
 
Domain Number 2 Region: 5-78
Classification Level Classification E-value
Superfamily DNA polymerase beta, N-terminal domain-like 0.0000000000144
Family DNA polymerase beta, N-terminal domain-like 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0F4JNR3
Sequence length 333
Comment (tr|A0A0F4JNR3|A0A0F4JNR3_9ACTN) Uncharacterized protein {ECO:0000313|EMBL:KJY34566.1} KW=Complete proteome; Reference proteome OX=1609134 OS=Streptomyces sp. NRRL S-444. GN=VR46_32570 OC=Streptomyces.
Sequence
MTPDEALRRIAFLLEWRGASPYRVRAFHTAADAVRHLPPGPVDAAQAARLRGVGPVTAEV
IAQASTGAMPRYLARLEAEADPAALAGWDLAAASTGDCHLHSDWSDGGSPLETMADAARA
LGHQWAVLTDHSPRLTIAHGLSPERLETQLEAVAAVNSRMGPDFRLLTGIECDILEDGSL
DQEEGLLGRLDVVVASVHSKLRSEPEPMTARLLAAVSNPHVDVLGHCTGRIITGRGRPQS
RFDAEAVFAACAEAGTAVEINCRPERRDPPDDLLVQAAAAGCRFAVDTDAHAPEQLHWQS
TGYARAARVGLGADRLITTWPLGRLLTSRSSRP
Download sequence
Identical sequences A0A0F4JNR3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]