SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F4K6I0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F4K6I0
Domain Number 1 Region: 26-84,136-184
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000000000304
Family SMI1/KNR4-like 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0F4K6I0
Sequence length 229
Comment (tr|A0A0F4K6I0|A0A0F4K6I0_9ACTN) Cell wall assembly protein {ECO:0000313|EMBL:KJY41985.1} KW=Complete proteome; Reference proteome OX=1609106 OS=Streptomyces sp. NRRL B-1568. GN=VR41_09790 OC=Streptomyces.
Sequence
MVDQQWNGVRQRVAALATQPSSGEVFGSLGHKWALEDPLTDDALAELEAQVGVELPDDYR
NFLTVVGAGGAGPAYGLFPVRRVQGRWRWEGDGADLADLSMLARPFPDHSPDPESLDALL
AERPEEEDFDEIEDFDDAIEAWDERWEALMFAPERTAGAIVISHLGCAQREWLIISGTHR
GTIWSDCRADDADLAPLLDGNGAPVTFARWYTDWLQEAERIARQPPAKA
Download sequence
Identical sequences A0A0F4K6I0
WP_045933805.1.101771

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]