SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F4RIU0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F4RIU0
Domain Number 1 Region: 6-104
Classification Level Classification E-value
Superfamily S-adenosylmethionine decarboxylase 3.06e-25
Family Bacterial S-adenosylmethionine decarboxylase 0.00083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0F4RIU0
Sequence length 117
Comment (tr|A0A0F4RIU0|A0A0F4RIU0_9RHOB) Adenosylmethionine decarboxylase {ECO:0000256|SAAS:SAAS00951950} KW=Complete proteome; Reference proteome OX=579483 OS=Loktanella sp. S4079. GN=TW80_14425 OC=Rhodobacteraceae; Loktanella.
Sequence
MAEFYDASALEECAPAAAVLRAAAEAANATVLDVKLHDFGERAGFTGVALLAESHISIHT
WPEFGYAAIDIFMCGDADLESCLKVLRDYFQPSDESLRVLDRGVGGQPSEMRQARIA
Download sequence
Identical sequences A0A0F4RIU0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]