SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F4TG64 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F4TG64
Domain Number 1 Region: 1-150
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 1.96e-34
Family SMI1/KNR4-like 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0F4TG64
Sequence length 154
Comment (tr|A0A0F4TG64|A0A0F4TG64_PSEFL) Uncharacterized protein {ECO:0000313|EMBL:KJZ43079.1} KW=Complete proteome OX=294 OS=Pseudomonas fluorescens. GN=VC35_21835 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MNKPTLLELENLIKQHPDIAAFGSPADAVSDDWLVKAEKKIRHKLPASYKWFLLNYAGGE
VGTEEIYSIYGMDFEDINGGDIVFQHLNGLKHKSTTAKKVVISETDLGEVFFFDYDTYNG
EECQIFIRIPSGQNLLYANNFYEFLAKRIKAFLP
Download sequence
Identical sequences A0A0F4TG64
WP_046042531.1.59402

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]