SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F4TJB5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F4TJB5
Domain Number 1 Region: 3-172
Classification Level Classification E-value
Superfamily RibA-like 4.58e-64
Family RibA-like 0.000000794
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0F4TJB5
Sequence length 205
Comment (tr|A0A0F4TJB5|A0A0F4TJB5_PSEFL) GTP cyclohydrolase II {ECO:0000256|HAMAP-Rule:MF_00179} KW=Complete proteome OX=294 OS=Pseudomonas fluorescens. GN=VC35_17225 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MPVAFVAACKLPTPFAQFTMHGFLDEATGREHVVLSLGEFDDGAPVLGRLHSECLTGDAL
FSQRCDCGSQLEAALQAIAREGRGVLLYLRQEGRGIGLLNKIRAYELQDGGADTVEANER
LGFAADQRDYAMCLPMLEHMGVKSLRLMTNNPRKVKALTDMGIVVAERVPLHTGHNPHNR
LYLATKASKLDHMMGNEHQGEVDRA
Download sequence
Identical sequences A0A0F4TJB5 A0A1H2PGW1
WP_046041645.1.59402 WP_046041645.1.7443

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]