SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F4VYY6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F4VYY6
Domain Number 1 Region: 116-245
Classification Level Classification E-value
Superfamily N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) 8.11e-28
Family N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) 0.00085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0F4VYY6
Sequence length 249
Comment (tr|A0A0F4VYY6|A0A0F4VYY6_9CLOT) Circadian phase modifier {ECO:0000313|EMBL:KJZ86713.1} KW=Complete proteome OX=1523154 OS=Clostridium sp. IBUN125C. GN=ClosIBUN125C_CONTIG4g00113 OC=Clostridium.
Sequence
MELKEVLTKLKNNQISVEEAEKYLRKQPFEEMGYAKLDTHRKVRSGFSEVIFCSGKADEH
LINIFGKLYEEDGEVFGTRADEHQYKLIKDKYHQVEYDHISHILKIDKKNKKRIGKIAVC
TAGTADICVAEEAAQTAEYFGSNVERIYDVGVAGIHRLLSKLDIIQSANCVIAVAGMEGA
LASVIGGLVDKPVIAVPTSVGYGASMNGLAPLLTMINSCANGIAVVNIDNGYGAGYIATQ
INRMGEKNE
Download sequence
Identical sequences A0A0A6SG05 A0A0F4VYY6 A0A0F4W0P3
WP_043665441.1.1134 WP_043665441.1.36140 WP_043665441.1.80740 WP_043665441.1.86677

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]