SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F4X643 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F4X643
Domain Number 1 Region: 510-552,589-637,752-776
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 7.07e-18
Family Regulator of G-protein signaling, RGS 0.0067
Further Details:      
 
Domain Number 2 Region: 345-464
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000000234
Family DEP domain 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0F4X643
Sequence length 785
Comment (tr|A0A0F4X643|A0A0F4X643_HANUV) Uncharacterized protein {ECO:0000313|EMBL:KKA01425.1} KW=Complete proteome; Reference proteome OX=1246595 OS=Hanseniaspora uvarum DSM 2768. GN=D499_0AE00520 OC=Saccharomycetes; Saccharomycetales; Saccharomycodaceae; Hanseniaspora.
Sequence
MTDILKSKDNTNNDSITINKRISVSDLIQESLSLKSFISLTNTVNEEKAIKTSKKTLHEV
TTKDFNRTPKGLMFAKDIKDIFCIILICLDLKGRLVDNTSTHRKKRNFFFNLAFSSNKEV
SNEAYFCFSLDDCIEEMHKLAVNIEMETTTVSISYSIKPEMSLQLIKIFFNAKLLYTPTD
RTNTELNNKSLLQPTPKGVSILTKYIKDMGIKKHIPGIVFSNLNSTYLFNFERSSVTDRI
IYNHYFIKLIFTKMFSDSPTIWTPDTKPEKIASLKTLLGNDNNVNEFDFTDKQAQNIMDL
ISHHHNQTLPVTLNPFADKNIVVPDEINDTALLNNENRISPLYHKFFTNPESDSHVQYYS
HINGIRMYKNKEFIESIKTEKNTIKSKKHVISYSFSTKAIVQWLMDCTDLIYFKEAVIMA
SLFYKCGLIKPICYSPSVAKEDNFTVSKKNLYTFTKKGCDWLNWNENFMESLYSDWNQER
KKRLNQLEESVVTTDFNKEEIHSDTYDLNKENHIISLESVLNDPGKRFLFKSHLDKEMCS
ENFSAYCDIKKLLKKMSNLENFVDVKEKNKRLANKNAKSIQLYNSLKARLMKESNESLSM
AYQIFATYIADRASKLINIDYYLRNSISTVILNSNSSLTATSSLNPFKEVLEPKEPATSD
ESPKMKNLVIEDAVDPVTKNNTTEWPIKTTNLDRKTKPIELNILNDSSKKIINKDSEYYF
SNQILRDNQVLDSPTEGLVTHSLYILSKLKPLFEDVNRKLYKIMETDSLPKFLNSNKDIL
DDVIQ
Download sequence
Identical sequences A0A0F4X643

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]