SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F4XKI2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F4XKI2
Domain Number 1 Region: 11-133
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 9.03e-18
Family SMI1/KNR4-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0F4XKI2
Sequence length 136
Comment (tr|A0A0F4XKI2|A0A0F4XKI2_9PSED) Uncharacterized protein {ECO:0000313|EMBL:KKA06305.1} KW=Complete proteome OX=132476 OS=Pseudomonas kilonensis. GN=VP02_19355 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MRLTLEESERALSVQELNEFQEKFNVELPTAFRQFYLKHNGGDLSESSSENDFLLGGFTP
IKYGQAPIETVYRDLTDDVPLLKQMIPFAYDHGGNSFLLSVKEADFGNIYLYLMDEEDLA
FVCESFEEFLAELTGQ
Download sequence
Identical sequences A0A0F4XKI2 F2K725
WP_013694578.1.1542 WP_013694578.1.16574 WP_013694578.1.22661 WP_013694578.1.35230 WP_013694578.1.48623 gi|330812644|ref|YP_004357106.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]