SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F4YU76 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F4YU76
Domain Number 1 Region: 144-231,282-347
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 1.47e-18
Family SMI1/KNR4-like 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0F4YU76
Sequence length 552
Comment (tr|A0A0F4YU76|A0A0F4YU76_TALEM) 1,3-beta-glucan synthase {ECO:0000313|EMBL:KKA21837.1} KW=Complete proteome; Reference proteome OX=1408163 OS=Rasamsonia emersonii CBS 393.64. GN=T310_4110 OC=Eurotiomycetidae; Eurotiales; Trichocomaceae; Rasamsonia.
Sequence
MPPVTSSITSAWRSFWHTMTSNDRHASHDSPYRTGQHVPLSQSRHAPLTSVVTSAAESHP
DLTTPFEEEENHKGSLSSNSNGWPGSPGGPGSPTQPYSPGMRSLTSQKRRSNDQSAPDGA
GPGEIQMQSFHDGAPPPPPVSHSWAKIDRWAEKNYEELYDQLGEGCTLNDVNELEHELDC
SLPLEVRESLQIHDGQERGGLPTGIIFGCMLLDCEEIVQEWKNWRTVNESFFNNIPSQPP
SKSGSSSAGPSHQASNPMWRQELLERQDSQPPGAVQKAYAHPGWIPLARDWGGNNIAVDL
APGPTGKWGQVIIFGRDYDCKYVVARSWAAFLAIVADDITSNKVFVDEETGELKLKEFPN
QNVEPPYLEILRWRVDQKYGRRPPRRKPANGLGLSTGPGKARDSPYGSPTPGEERGRSPH
RFSNRGPNQSPKTPFAISSPLARVTEEASSPVNATSSGDDKAQDSATKEPEKTSQGDDLL
EMATSDAQGKDNGDSSSQEKTQDKVKEQEQEQEQEPKQDEVVSEKVVEKEAKLESSTGLD
TENLGEMKTVAI
Download sequence
Identical sequences A0A0F4YU76
XP_013328449.1.46894

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]