SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F4YYX7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F4YYX7
Domain Number 1 Region: 413-560
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.09e-20
Family Regulator of G-protein signaling, RGS 0.0037
Further Details:      
 
Domain Number 2 Region: 847-962
Classification Level Classification E-value
Superfamily PX domain 1.28e-20
Family PX domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0F4YYX7
Sequence length 1200
Comment (tr|A0A0F4YYX7|A0A0F4YYX7_TALEM) Intermediate filament protein (Mdm1) {ECO:0000313|EMBL:KKA23449.1} KW=Complete proteome; Reference proteome OX=1408163 OS=Rasamsonia emersonii CBS 393.64. GN=T310_2515 OC=Eurotiomycetidae; Eurotiales; Trichocomaceae; Rasamsonia.
Sequence
MALSRQHVILAGLCGFISWGLIVSWIPVARYLGYAFVSGASLVLVALLGLVLLTVRSKSN
DGRHQRVSPTVAFLTPDNWRREVNNYRKIAAYEPTSLYPQSFVVSEGIDDLLRLVSRDFI
SSWYQNISPSPVFIHEVDKAIRIALGNLRDRLLSEDLVSIVVSRIFPILTTHLKEFDRAE
RAVRGRNLTRNVTESEELDFAIASKYRDGRLHPAVAVSFSDQKSLQQEHLRKVVVGLLPQ
LLPENLLNSRAVSVLIREIVACAVLFPLVTLLSDPDTWNQLIETYGRTALQDRKTVRKLR
AALDEHASPVSKSKQVQPFPKLRPNDSERSFERFVRAIRRCNNLSDARRFRAQIASQLKR
ESMVDGQDQVYLRRLETGKRVLDQKVAKLSSTGSVSRPAAARPDVRRNSAPKLHEASLVD
IMHDAAGLSYFMEFMDRQRRMSLVQFWIVVDGFRNPLEDDFGDETSVASTTWTATDVNDM
ILISETYFSKPELNVPEESRKAVKAFLSAGKKATPEQYRKARTAILTTQSAVLEELQEVY
FPKFKQSDLYYKYLSSDETSTSAPQPGPPRTMTSSPAPETSERRPLPTLMTRTMSQPSMK
PRDLRRAAVSSSDGRNTGRLFDDADSPRHSFDSERSAPLFDDDYDTDPLAMSTHSIGKDS
QNGESEAKNNQVIENMEAALNDIITNEPKNGKVDGVTSPVSLFSEDKERNSPRGSLDGPR
ADSRSTEKPKPSIASLGLVDPSSRTGVFDDELFPDEKKFIEDEYADPEEEDEKDPADEIH
EAAPGDLGLAEAIAALTEDIEKLAAQESVLDALTRKAELTNNTAELRILGKSKASIQREI
RRKEMQRQQYIIQESDSSLYGRSTVQIKSIMVGKEEDGREFALYVIEVHRKAGEQMPAAT
WAVTRRYSEFHELHQKLRMRYASVRQLEFPRRRVVMKLQKDFLQKRRAALEAYLQQLLLL
PEAEPAADGEAKDIVSRIYNSVADGMEDFLGNIAMLDQLSAAGQSLISAATNQLSSSEPA
LATEDAVTAAEAEAELNAFEDRELEPFIKPICDLFLEVFELNKGNNWLRGRAVVMVLHQL
LGGTIERKVRDSAKSFVQDDSLLRYISLAKDTLWPGGVLRPPVVRTPSQKSRSRTEASFM
LAALIPDMAGNVVGRANAQAAARRIFATLNNQRLNMHLVLTILDEIVLVLFGGADAGRVR
Download sequence
Identical sequences A0A0F4YYX7
XP_013330061.1.46894

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]