SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F4ZA83 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F4ZA83
Domain Number 1 Region: 1084-1196
Classification Level Classification E-value
Superfamily PX domain 5.36e-26
Family PX domain 0.00053
Further Details:      
 
Domain Number 2 Region: 84-234
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 1.69e-20
Family TrmB-like 0.014
Further Details:      
 
Domain Number 3 Region: 697-850
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 7.65e-20
Family Regulator of G-protein signaling, RGS 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0F4ZA83
Sequence length 1439
Comment (tr|A0A0F4ZA83|A0A0F4ZA83_9PEZI) tRNA(m7G46)-methyltransferase {ECO:0000256|HAMAP-Rule:MF_03055} KW=Complete proteome; Reference proteome OX=72032 OS=Thielaviopsis punctulata. GN=TD95_005000 OC=Thielaviopsis.
Sequence
MSDESKKQSKRQAYEEAREGEGAAELPRKRFYRQRAHANPFSDHDLTYPISPRHMDWSEY
YPDFVAEGCKVGDVDALGLPAPIQKKVEVVDIGCGFGGLLVSLAPLLPDTLMLGMEIRTK
VAKFVQDRIVALRKQNPDSSVYKNIGCIRANSMKFLPNFFEKAQLSKIFICFPDPHFKTR
KHKARIVSATLNSEYAYALRPGGIIYTITDVEDLHIWMVEHLDAHPAFERISKEEEEADV
YAKTMATATEESHKVDRNNGPKFVALYRRLPDPECRSRNHSPGFSTMALKGRDMAIASVV
VFIAWGHAIHWLPMLRWLGYAFVAGSLATVLGGAALVLTTARSSTARRSQRSERPSAVVF
SDRRIWAAEVAALKDRQTHVKTPVYAASEKVSKTVDTLLEYIIRDFVNSWYSKISSDPAF
LNEVDNVLRVALCSLRDRLMELDLVDVIISRIVPILTNHIRDFRVAEVIVRGRKLNRSMT
ETEELDLAIASKFRDGELHAAASLSFPDMKMIQQDYLRTTVAKMLLHLLPPQLLTSRAVT
TIIRELVACAVMSPIMGLLCEPDTWNQLMENVGRSMLQDRSTVRRLRAALDEHAPNVSPA
SKGSLIPLLAPGDTERQFEKFIRAIRRINNLSDARRFRSQVASQLKRDSQQDNPDAVYLR
RLEMGKRALDQKVQYLISGNAAADRRGSVPLPFTDPIIPTVSRLETASLAEILRDASGMS
YFMEYMDRQRQMPLVQFWLVVDGFRNPLEDDGLDDQLPTNLPQWKEADRLDLQQMYQAYL
SRPELKVTHQYRDPVREFLSTGPKATAVQYYRARKAILAAQTAVLEQMQSLYFQSFKKSD
LFYKCLASQEASAVVVSRPMSPEPSQQDPLSTSFPIRPSPKKRSSPSFNIGRVTKPARTH
KRGNSIDNFITPSRLGFEEQNNPSIKYDDGEKDSMVDSIQSLEQEAEPRHNIPDRQIVKA
MEQALVDIMEDGNQPQTAEDFRASLFDNDDLGSSGIFSADNDSGRGSLDGPSGNSRLSLL
KEAEKPNAIVESLTRKAELTNNTAELRILRKSKSSIQRELRRKTLQRQHYIIQESDNSLY
GRSTIQIKSTTTSKDDEGREFVLYIVEVQRDAGEQMPAATWEVIRRYSEFHELHQKLRSR
YPSVRTLDFPRRRVVMKFQADFLRKRQQALEKYLREVLQLPDVCRSRELRAFLSQSAVGG
GAEQNGKTSHKKDMITRFYDSVTDGVEDILGNIPVLDQLSLAGQNLIAAATSQLNASSLA
AGEDGTIAVAEAEAELNAFENKDVEPFIKPICDIFLEVFELNRGNNWLRGRAVVVVLQQL
LGGTIERKVRENSRNLVHEDAVQRYMARVMDGLWPDGQWNRSKKPRSEQEKKKTRTEASL
LLATLVPDLAGSVVGRANAQAASRRIFATLNNARLNAHLAFTILDEIMKALFDEDASSS
Download sequence
Identical sequences A0A0F4ZA83

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]