SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F4ZHA9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F4ZHA9
Domain Number 1 Region: 24-201
Classification Level Classification E-value
Superfamily Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 1.57e-22
Family Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 0.0007
Further Details:      
 
Domain Number 2 Region: 408-512
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000000183
Family Pseudo ankyrin repeat 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0F4ZHA9
Sequence length 608
Comment (tr|A0A0F4ZHA9|A0A0F4ZHA9_9PEZI) Uncharacterized protein {ECO:0000313|EMBL:KKA29501.1} KW=Complete proteome; Reference proteome OX=72032 OS=Thielaviopsis punctulata. GN=TD95_001578 OC=Thielaviopsis.
Sequence
MADISRILRTASPALSLGDSARPRNLHLLVASTGSRDTSWAQALVVRLSKSQNIDMRAVV
DDPVPRLQQTCTTWHNRSLAIPPPDLLKQQQQQLQPQSAARQAPSELEIYRKQACDLVDW
ADILVLAPLDADAISKMLAGFADTMLLRILRGWDTSKRILLVPGMSRQCFANHMTQRQLD
DIHTNWPWIRTLPPIQWHYDGTADCKRIVQWSGFNEVVHIIRNQADLFSIGRDIDVTAPF
NAINGNQRSSHVRLPPELWSMIMDFTGDWELSQALGIYSHNQEPEAWKARKADKTKTPGG
LFGIELEDITLRESQAVICHKLSQAPPDFKELTPLTIKLIVRFSLISVLEYLEANRPDLF
RAAFDNVSFTLMASAYYGRTDVLDFWKRSPTFKGRHSQLYTVDAVNGASENGFTHVLDWW
WRHSGLPMLYTEKALEQASGRGHLRVLEWWRDVTMQDESIAPRPGRSLLVAAQNNQLEVI
RWWHTSGIAVAHGDHIPRMASQWGRVDVLELWRQLQGDDKLVYDAEVLTAPTTHQHIDVL
SWWIKYARGELPGMEGRKHKVPYRTCTIEEALEDSFGDQNVVRKWWTENGLNLGLRNFEW
MKIKYLGF
Download sequence
Identical sequences A0A0F4ZHA9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]