SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F4ZIB8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F4ZIB8
Domain Number 1 Region: 9-60,170-251
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 7.72e-22
Family Regulator of G-protein signaling, RGS 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0F4ZIB8
Sequence length 366
Comment (tr|A0A0F4ZIB8|A0A0F4ZIB8_9PEZI) Uncharacterized protein {ECO:0000313|EMBL:KKA29955.1} KW=Complete proteome; Reference proteome OX=72032 OS=Thielaviopsis punctulata. GN=TD95_003782 OC=Thielaviopsis.
Sequence
MPGPTPSPIPDINRNRLPQLFEVLSRRTLPPVDLFSFYIYMRDQQRSVDYLDFWLDVSQH
MSLCRHYVRELRRSVLVSTPEMGNTSKRSSQILESMGDMGAEAGPSNLYTSEKDRQKEKD
QDAKMSAFLRGDYDNPDAENLPGRHESPAPGTGSPGLSPRALTDSNSPAHTVLRQDIRAS
AEKILYTFLMPNAEREIILPGAITQDITIAIQEHGRDDPEVFDVAKDYVFQAMERDAFPG
FLRQKALGNLIPPTLVLRLIIGLLSIFAAFWAGFVLIFLDKSRLTRCWVILPFTIGVYML
SSYQYSLDPILALIGFSEYTPFNFSRIKEPFVRKMLTRRAITLLFVIVVIDAALCLLFIL
VPGKRL
Download sequence
Identical sequences A0A0F4ZIB8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]