SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F4ZKG0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F4ZKG0
Domain Number 1 Region: 501-652
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 2.5e-29
Family Regulator of G-protein signaling, RGS 0.00085
Further Details:      
 
Domain Number 2 Region: 354-467
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.63e-26
Family DEP domain 0.0049
Further Details:      
 
Domain Number 3 Region: 178-305
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000163
Family PadR-like 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0F4ZKG0
Sequence length 675
Comment (tr|A0A0F4ZKG0|A0A0F4ZKG0_9PEZI) Uncharacterized protein {ECO:0000313|EMBL:KKA30338.1} KW=Complete proteome; Reference proteome OX=72032 OS=Thielaviopsis punctulata. GN=TD95_002255 OC=Thielaviopsis.
Sequence
MKLDRRFPSSSLHMTASNPPPPVALASSNKLPSRRQSLSQSLSSRSRSISYTAAQTKSLF
TSLAASAIGSLTDSSPPPPLPTHRPSTSSILPANSLLLAPADPGKVLSARSSKSSLKTDY
SLFSGASSKEPPSATSFVSKPYTETDATCPLPIKIERPGNTMHQTSSRLLRMTDDDRPFT
RDFKDLFSTLIVSLLPLGSHRVRLTRVDYTFLSEDAINNLSSLKFSQSNRMPDPKDPSRI
VTTTTTTTFSMARDMARSICQRFVEARFIESADGRYQQVYSMKGQVWQLTPKGIAILDRF
CQRNGIQQKQVAELIGHGPMQLVILERSIQTDKLLTDKGVIDVIFRRFIGARGPNIKSTV
SSADSDSLHDYRDGLTGVKMASERRINGRVYKDTFTGKAACDWLMDCCTMVERKEVVELA
SLFVENNLIESVMPDRAHIAQHPQMTHFQPTKYAIYQLTQRGKDVVNGTAARGRSSEGGT
APAAPTDAASVSARIVSGRDSNTQRLDKILNDAALRLLFRENLRETHCEENLSFYMDVDE
FVQSCRLAIRNNQKNSATSAETIKEIMAQAYGIYNAFLAPGSPCELNIDHQLRNNLATRM
TKAVGKEVTMVETLQDVMSLFEDAQTAVFKLMASDSVPKFLKSPKYEQTLREYDLDIGSA
PGRGPERSQSRSIRN
Download sequence
Identical sequences A0A0F4ZKG0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]