SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F5F2S8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F5F2S8
Domain Number 1 Region: 11-205
Classification Level Classification E-value
Superfamily Chemotaxis phosphatase CheZ 1.57e-42
Family Chemotaxis phosphatase CheZ 0.00000951
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0F5F2S8
Sequence length 206
Comment (tr|A0A0F5F2S8|A0A0F5F2S8_9GAMM) Chemotaxis protein CheZ {ECO:0000256|PIRNR:PIRNR002884} KW=Complete proteome OX=470931 OS=Pantoea anthophila. GN=TN98_18225 OC=Erwiniaceae; Pantoea.
Sequence
MSLPDTHSEQQEITEITARAGAILRTLRDSLQQLGLDKTIAEVAGSIPNARERLGYVVTL
TREAADEVINSVEITQPVQTQLTEKADRLLQRWNATSAESLTKEQTHLLAADTVALLNDV
PHATNLTRQHLHAIMMAQGFQDITGQIVQAMMAVLNQAEQQLIQVIRDKSASPASAARAT
PPAPAFSAEPAASQDDVDDLLASLGI
Download sequence
Identical sequences A0A0F5F2S8
WP_046102705.1.38598

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]