SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F5I4D5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F5I4D5
Domain Number 1 Region: 138-281
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 1.65e-53
Family AadK C-terminal domain-like 0.00000657
Further Details:      
 
Domain Number 2 Region: 1-133
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 2.22e-47
Family AadK N-terminal domain-like 0.00000256
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0F5I4D5
Sequence length 286
Comment (tr|A0A0F5I4D5|A0A0F5I4D5_9BACI) Putative aminoglycoside 6-adenylyltansferase {ECO:0000313|EMBL:KKB40007.1} KW=Complete proteome; Reference proteome OX=1221996 OS=Quasibacillus thermotolerans. GN=QY95_01879 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Quasibacillus.
Sequence
MRSKKEMMDLGMNFALNCEKIRLFTLEGSLTNTNIPKDEFQDYDFSYFVTDMDYFKKSDD
WLSSFGERIIMQKPEAMELYPPELGNWYSYLMIFEDGTKIDLTLIPLNEYEDYFKNSDGL
VEVLLDKDNLIQNSVIPTDSMYHIQKPSEQSFDDCCNEFWMTSTYVVKGLARREILFAID
IMNNAFRPSLHTMLRWKVGMETGFSLSIGKSDKFLKEYISEDMWNKVLSTYDMGSYKKMW
EALNTSIELFRETSHFIAETFGFKYPNYDEKVSMYIESIRKKYTQF
Download sequence
Identical sequences A0A0F5I4D5 A0A2C1KSP8
WP_035400726.1.9427 WP_035400726.1.99253

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]