SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F5IQ03 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F5IQ03
Domain Number 1 Region: 168-329
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 1.07e-16
Family SMI1/KNR4-like 0.011
Further Details:      
 
Domain Number 2 Region: 10-156
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000000000222
Family SMI1/KNR4-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0F5IQ03
Sequence length 330
Comment (tr|A0A0F5IQ03|A0A0F5IQ03_9BACT) Uncharacterized protein {ECO:0000313|EMBL:KKB47440.1} KW=Complete proteome OX=1203610 OS=Parabacteroides gordonii MS-1. GN=HMPREF1536_05084 OC=Parabacteroides.
Sequence
MKIELENCQKSLTLKDFEEVESKLGHVLPERLKEFYLQYNGGEPKQQTISINKYYEVEIR
IFQPFKYNKSFKNALFHTVEGETLEHRSSNSISDNILLFASGHNNLRNIGVIAINIKNRA
VYFYKIIGFVKNSDAFIFDEPQLIADSIDDFFNNLVAFPKIEEEQQTEIIEIEGVMPELS
DCSASLTKEDIKNFEVELNVKIPAGMKNFYLKFNGGMPSPYCFQPQDEDLDWVEINAFFP
IKERTNAFETIEVIAKDMWSRNLMPSNLLPFAMDSGGNYYALNLKNKKIYYYLTDEWDEN
ASREYNFETNTRYIAQSFNYFINHFIEEEE
Download sequence
Identical sequences A0A0F5IQ03 A0A174U083

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]