SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F5RGH0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F5RGH0
Domain Number 1 Region: 8-143
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 5.23e-22
Family SMI1/KNR4-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0F5RGH0
Sequence length 150
Comment (tr|A0A0F5RGH0|A0A0F5RGH0_9BACI) SMI1 / KNR4 family protein {ECO:0000313|EMBL:KKC52083.1} KW=Complete proteome OX=1565146 OS=Bacillus sp. UMTAT18. GN=OA45_05629 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
Sequence
MHNIVWVGVSNEKVTDHEIEQVEKYFNIKLPNDFIECVKKYDGGYPRPKIFDVPGQDENV
FNDLLTFHIEDEYSIVKNYEDIKEELLDNIYPFANDPFGNFLCFDYRNNSALPTIVFWDH
EEEDMEKAIYPVCSTFTELLASLRDFEEED
Download sequence
Identical sequences A0A0F5RGH0 A0A0U0GPM3 A0A1K0AQL7 A0A2K1RT16 A1BZM4 B7JTY9 C2QL83 C2UNW2 Q638V2
288681.BCZK2978 405535.BCAH820_B0241 gi|52142265|ref|YP_084565.1| gi|218848493|ref|YP_002455123.1|NC_011777 gi|218848493|ref|YP_002455123.1| WP_000551585.1.16013 WP_000551585.1.20651 WP_000551585.1.26450 WP_000551585.1.29451 WP_000551585.1.30336 WP_000551585.1.35255 WP_000551585.1.39538 WP_000551585.1.47441 WP_000551585.1.47975 WP_000551585.1.55116 WP_000551585.1.58328 WP_000551585.1.64666 WP_000551585.1.67001 WP_000551585.1.67873 WP_000551585.1.68562 WP_000551585.1.69323 WP_000551585.1.69970 WP_000551585.1.7545 WP_000551585.1.76902 WP_000551585.1.77902 WP_000551585.1.80649 WP_000551585.1.83938 WP_000551585.1.97842 WP_000551585.1.98604

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]