SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F5RQL9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F5RQL9
Domain Number 1 Region: 1-157
Classification Level Classification E-value
Superfamily Obg GTP-binding protein N-terminal domain 2.62e-54
Family Obg GTP-binding protein N-terminal domain 0.000000155
Further Details:      
 
Domain Number 2 Region: 160-334
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.68e-52
Family G proteins 0.000000158
Further Details:      
 
Domain Number 3 Region: 357-428
Classification Level Classification E-value
Superfamily Obg GTP-binding protein C-terminal domain 1.57e-23
Family Obg GTP-binding protein C-terminal domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0F5RQL9
Sequence length 428
Comment (tr|A0A0F5RQL9|A0A0F5RQL9_9BACI) GTP-binding protein Obg {ECO:0000256|HAMAP-Rule:MF_01454} KW=Complete proteome OX=1565146 OS=Bacillus sp. UMTAT18. GN=OA45_02126 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
Sequence
MFVDQVKIYVKGGDGGNGMVAYRREKYVPKGGPAGGDGGKGADVVFIVEEGLRTLMDFRY
QRHFKADRGQHGMSKGQHGRKSEDLLVKVPPGTVVKDEKTGQILADLVTHGQTAVIAKGG
RGGRGNSRFATATNPAPEIAENGEPGQERDVILELKVLADVGLVGFPSVGKSTLLSVVSS
ARPKIAEYHFTTIVPNLGVVETGDNRSFVMADLPGLIEGAHAGVGLGHQFLRHIERTRVI
VHVIDMSGLEGRDPYEDYVTINNELKEYNLRLTERPQVVVANKMDMPDAEENLQAFKEKV
GDEVKIFPISAVTRQGVRDLLFEVANLIETTPEFPIHEVADESDTSVMYKFDTEGVKFEI
TRESDGTFVISGYDIEKTFKMTDFSRDESVRRFARQMRGMGIDEALRARGAKDGDIVKIL
EYEFEFID
Download sequence
Identical sequences A0A063CRA7 A0A0F5RQL9 A0A0P0PI29 A0A0T8SA27 A0A1J9T6Z9 A0A2A9AMT9 C2QYU3 C3C8F8
WP_000497112.1.1228 WP_000497112.1.195 WP_000497112.1.20973 WP_000497112.1.226 WP_000497112.1.2521 WP_000497112.1.28913 WP_000497112.1.3026 WP_000497112.1.30317 WP_000497112.1.31503 WP_000497112.1.35255 WP_000497112.1.35518 WP_000497112.1.3561 WP_000497112.1.3612 WP_000497112.1.51335 WP_000497112.1.52494 WP_000497112.1.53621 WP_000497112.1.62107 WP_000497112.1.6340 WP_000497112.1.67108 WP_000497112.1.69970 WP_000497112.1.71441 WP_000497112.1.7398 WP_000497112.1.7628 WP_000497112.1.84422 WP_000497112.1.88431 WP_000497112.1.98557 WP_000497112.1.98571

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]