SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F5VCT7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F5VCT7
Domain Number 1 Region: 1-140
Classification Level Classification E-value
Superfamily Ribosomal protein L13 6.15e-62
Family Ribosomal protein L13 0.000000343
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0F5VCT7
Sequence length 142
Comment (tr|A0A0F5VCT7|A0A0F5VCT7_9GAMM) 50S ribosomal protein L13 {ECO:0000256|HAMAP-Rule:MF_01366, ECO:0000256|RuleBase:RU003878, ECO:0000256|SAAS:SAAS00725370} KW=Complete proteome; Reference proteome OX=265726 OS=Photobacterium halotolerans. GN=KY46_10435 OC=Vibrionaceae; Photobacterium.
Sequence
MKTFVAKPETVKRDWYVVDAEGKTLGRLATEIASRLRGKHKPEYTPHVDTGDYIVVINAE
KVAVTGAKRTDKMYHRHTGYIGGLKTISFDKLLEKKPEAIIEIAVKGMLPKGPLGRAMYR
KLKVYAGSEHNHAAQQPQVLDI
Download sequence
Identical sequences A0A0F5VCT7
WP_027253695.1.85145 WP_027253695.1.89714

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]