SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F5VG48 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F5VG48
Domain Number 1 Region: 27-239
Classification Level Classification E-value
Superfamily Chemotaxis phosphatase CheZ 1.44e-63
Family Chemotaxis phosphatase CheZ 0.0000268
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0F5VG48
Sequence length 240
Comment (tr|A0A0F5VG48|A0A0F5VG48_9GAMM) Chemotaxis protein CheZ {ECO:0000256|PIRNR:PIRNR002884} KW=Complete proteome; Reference proteome OX=265726 OS=Photobacterium halotolerans. GN=KY46_05155 OC=Vibrionaceae; Photobacterium.
Sequence
MISLEQAKQLVALLEEDRQADADELFRSLVSDCRDPMYLEVGKLTRQLHDSLQNFRLDPR
IADLATTDIPDARGRLNYVIDKTEEAANRTMDAVEGTLPIADLLRERLMQVKPQWQSLMH
GAITLGEFKQLCHDIDALLVQLDGDSETLHRHLTEILMAQDFQDLTGQVIRRVIELVHEV
EHQLVEILKAAGIEQSESSVVVSQKDKTLSPEGPIINSAERTDVMSTQDDVDDLLSSLGF
Download sequence
Identical sequences A0A0F5VG48
WP_046219513.1.89714

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]