SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F5Z2A8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F5Z2A8
Domain Number 1 Region: 29-86,116-203
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.000000000000379
Family SMI1/KNR4-like 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0F5Z2A8
Sequence length 210
Comment (tr|A0A0F5Z2A8|A0A0F5Z2A8_LISSE) Uncharacterized protein {ECO:0000313|EMBL:KKD45133.1} KW=Complete proteome OX=1640 OS=Listeria seeligeri. GN=UQ68_12650 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Listeriaceae; Listeria.
Sequence
MDVHHDIIQRIQSKITKLKSLDMNLTLFGAETHNYEFQAPLSDTSIRQFEKLHQINLPSS
YRIFLQQIGDGGMGPYYGLEPLEDGLFASLDYKDAKYGLQNLSQPFSHIDEWNLPGDVNN
MSEEEYQTSEESYFQDDVANGLLRIANFGCGVSVNLVVNGEAYGEVWVDDRCNSNGIYPD
FYFGNEKRLDFFAWYELWLDKSINELEKPA
Download sequence
Identical sequences A0A0F5Z2A8
WP_046327969.1.96308

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]