SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F5Z4U2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F5Z4U2
Domain Number 1 Region: 33-158
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.000000000122
Family SMI1/KNR4-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0F5Z4U2
Sequence length 423
Comment (tr|A0A0F5Z4U2|A0A0F5Z4U2_LISSE) Uncharacterized protein {ECO:0000313|EMBL:KKD46194.1} KW=Complete proteome OX=1640 OS=Listeria seeligeri. GN=UQ68_06920 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Listeriaceae; Listeria.
Sequence
MRGDSINFCEFFKELNNQNTELHNAGARTMLVIDEGATDAQLAEVEKMLDISLPDDLKEI
LKLSKKIYWYWTLFGKTIIPSDFEQIKGTFSINLEEIEFFTAPLVKIKVRRLLKIAKSID
GEDIIYDLKEGSIYCFNYYHNQLFQMASSLEAYLAITIQNKGLAMWNYGLIGNKELKESA
FEFIREFLKPLVSDPDAVEIVNYACIHGAEEIISKGLPNEEDVGRVFTEIMHRLDADLNH
FKGYNNLIIELCPAYAKKWIISLWVSKKYEKIADFIYLRAYFTGKALPAKEALKLISETI
PDRASGKDVYRLLSTIGDSVIIDWMQDKVNYPLGDWVNLFLESQPTKEQVFSWLEGDIIY
QETVCLALKNLSKESELLKTYTKEEKMKLFILLLGVNHNCLFKKDKEEIIRAIRLIIKKF
FIE
Download sequence
Identical sequences A0A0F5Z4U2
WP_046326234.1.96308

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]