SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F6AG94 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F6AG94
Domain Number 1 Region: 70-202
Classification Level Classification E-value
Superfamily Chemotaxis phosphatase CheZ 0.0000732
Family Chemotaxis phosphatase CheZ 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0F6AG94
Sequence length 220
Comment (tr|A0A0F6AG94|A0A0F6AG94_9GAMM) Uncharacterized protein {ECO:0000313|EMBL:KKE85247.1} KW=Complete proteome; Reference proteome OX=1129367 OS=Pseudoalteromonas luteoviolacea S4054. GN=N479_05800 OC=Pseudoalteromonadaceae; Pseudoalteromonas.
Sequence
MPLKYLKIYALIAACALFSGCKSAQNAYYSAWEQVGVHKRDILVDRVEDTQQSQQTSQQE
FQNALERLSALIDFDGGELQSVYEQLNSDFEASQKAAQSVTDNIDKVESVADALFEEWQT
ELEEFSNPKLKRSSEQKLQQTQKQYDKLLRSMRKSESKMQPVLDSMKDNVLYLKHNLNAQ
AIAAIRGEFTNLKRDIQGLITDMNRSIADSTAFIEQMNKN
Download sequence
Identical sequences A0A0F6AG94
WP_046354612.1.25629 WP_046354612.1.44523 WP_046354612.1.44690 WP_046354612.1.91916 WP_046354612.1.98658

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]