SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F6ESW6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F6ESW6
Domain Number 1 Region: 9-96
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.000000458
Family SMI1/KNR4-like 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0F6ESW6
Sequence length 258
Comment (tr|A0A0F6ESW6|A0A0F6ESW6_PAEPO) Uncharacterized protein {ECO:0000313|EMBL:AIY09080.1} KW=Complete proteome OX=1406 OS=Paenibacillus polymyxa (Bacillus polymyxa). GN=LK13_11080 OC=Paenibacillus.
Sequence
MYWVSTQHTPVAADEMANFEHTHGITLPTPYASFLTQYGPGTYCGLLVIEPPDPQLLQSY
ADYELWTHDDNCPITAQQLGECVVIGSSIDGDFLAVHPQVEGLLWLPRHSEVITMKPLDV
QTPFTDTLEHILRDEFGKTEPFPRYFEPVSLDRTATFLLFNPPDTVKAYDPANPNDPIPN
IAPASIQVLAQRFKQHFDTNLWIENEHTCMAFFQLLGGYVRFNYAYGREVAIIYEPKAIA
LHDEILSFLQKEHCRVVE
Download sequence
Identical sequences A0A0F6ESW6
WP_025366048.1.29540 WP_025366048.1.78809

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]