SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F6EZE9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F6EZE9
Domain Number 1 Region: 140-279
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 1.73e-50
Family AadK C-terminal domain-like 0.0000759
Further Details:      
 
Domain Number 2 Region: 1-132
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 2.29e-45
Family AadK N-terminal domain-like 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0F6EZE9
Sequence length 289
Comment (tr|A0A0F6EZE9|A0A0F6EZE9_PAEPO) Aminoglycoside adenylyltransferase {ECO:0000313|EMBL:AIY11363.1} KW=Complete proteome OX=1406 OS=Paenibacillus polymyxa (Bacillus polymyxa). GN=LK13_23605 OC=Paenibacillus.
Sequence
MRSEQEMLHTILQFAQEDERVRAVIMNGSRANPHAPRDIFQDYDIVFLVSSMDSFIQERH
WIRRFGELIIMQTPDEHVEPTVTFRDRFAFLMLFTDGNRIDLTLCPVTNIANWPRDSLSV
LLLDKDGLVEPFPPPSLQDYKTVPQTAQTYADSCNEFWWVSTYVAKGLWRHELPYAKFML
DRPVRDALHLMLEWHMGIQTNFTADPGKQGKYFEKHLEPEHWTAYIQTFADADYEHMWQS
LFIMGNLFREVAQKVANHYGYRYPIEDDQRVTNYLYHVKALPADATGIY
Download sequence
Identical sequences A0A0F6EZE9
WP_025364751.1.29540 WP_025364751.1.78809

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]