SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F6FTI1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F6FTI1
Domain Number 1 Region: 10-154
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 1.96e-18
Family SMI1/KNR4-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0F6FTI1
Sequence length 156
Comment (tr|A0A0F6FTI1|A0A0F6FTI1_BACTK) SMI1 / KNR4 family protein {ECO:0000313|EMBL:AJK41658.1} KW=Complete proteome OX=29339 OS=Bacillus thuringiensis subsp. kurstaki. GN=BG08_4967 OC=Bacillus cereus group.
Sequence
MKIKNGSELQSPNDELIESFEEYCEIKLPNDFIDFLKKYNGSIPITNVFSHEKNELLIER
FLCLLEDPEDDDENGWYDIEVVLSDIDTRLTDDEDLTGINVIPFAVLFAGDFLCLDFREK
EIPSVVVWYHEESEELNPVTSEVADNFSEFLSMLKE
Download sequence
Identical sequences A0A0F6FTI1 A0A1D3N0H0 A0A243HCZ4 A0A2C4X901 A0A2C9YGF5 J8NTG3 R8N7X2 R8QLI3 R8UCU2
gi|557623031|ref|YP_008784163.1| WP_000694781.1.10845 WP_000694781.1.1112 WP_000694781.1.14039 WP_000694781.1.18749 WP_000694781.1.19516 WP_000694781.1.2206 WP_000694781.1.24969 WP_000694781.1.27106 WP_000694781.1.29836 WP_000694781.1.29993 WP_000694781.1.30144 WP_000694781.1.34175 WP_000694781.1.34587 WP_000694781.1.37239 WP_000694781.1.3798 WP_000694781.1.38427 WP_000694781.1.38591 WP_000694781.1.4185 WP_000694781.1.41879 WP_000694781.1.42167 WP_000694781.1.42218 WP_000694781.1.43767 WP_000694781.1.44497 WP_000694781.1.46586 WP_000694781.1.49455 WP_000694781.1.49702 WP_000694781.1.50694 WP_000694781.1.51047 WP_000694781.1.54736 WP_000694781.1.54777 WP_000694781.1.5543 WP_000694781.1.58586 WP_000694781.1.58632 WP_000694781.1.59997 WP_000694781.1.63743 WP_000694781.1.64568 WP_000694781.1.64764 WP_000694781.1.64770 WP_000694781.1.674 WP_000694781.1.6743 WP_000694781.1.68007 WP_000694781.1.68346 WP_000694781.1.69501 WP_000694781.1.70181 WP_000694781.1.73457 WP_000694781.1.74372 WP_000694781.1.74832 WP_000694781.1.74857 WP_000694781.1.74976 WP_000694781.1.75374 WP_000694781.1.7593 WP_000694781.1.76883 WP_000694781.1.77386 WP_000694781.1.77968 WP_000694781.1.81000 WP_000694781.1.81773 WP_000694781.1.83694 WP_000694781.1.83977 WP_000694781.1.85928 WP_000694781.1.86041 WP_000694781.1.87013 WP_000694781.1.87725 WP_000694781.1.89009 WP_000694781.1.8907 WP_000694781.1.90665 WP_000694781.1.93904 WP_000694781.1.97670 WP_000694781.1.9860 gi|449087707|ref|YP_007420148.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]