SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F6FVK4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0F6FVK4
Domain Number - Region: 369-438
Classification Level Classification E-value
Superfamily Tubulin chaperone cofactor A 0.0262
Family Tubulin chaperone cofactor A 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0F6FVK4
Sequence length 472
Comment (tr|A0A0F6FVK4|A0A0F6FVK4_BACTK) SpoVR like family protein {ECO:0000313|EMBL:AJK42381.1} KW=Complete proteome OX=29339 OS=Bacillus thuringiensis subsp. kurstaki. GN=BG08_5107 OC=Bacillus cereus group.
Sequence
MRASDDKALQYAIAEITEIATGFGLDFYPMRYEICPAEIIYTFGAYGMPTRFSHWSFGKQ
FFRMKLQYDLGLSKIYELVINSDPCYAFLLDTNSLIQNKLIVAHVLAHCDFFKNNIRFSN
TKRDMVESMAATADRVKAYEHKYGKAEVETFLDAVLAIQEHIDPSLMRPKLAWSIDDLEE
EEVEKKKVSQYDDLWNLDNRNKKQERSNIRKKKKIPPQPEKDLLLFIEEYSRELEDWQRD
ILTMMREEMLYFWPQLETKIMNEGWASYWHQRILREMDLTSDEAIEFAKLNAGVVQPSKT
SINPYYLGIKIFEDIEERYNNPTEEMKRRGVKPGSGRDKIFEVREIEWDVSFLRNYLNKD
LVMREDMYLFQRQGKEYKVIDKEWEHVRDQLVNMRTNGGFPYLVVEDGDYLKNGELYIKH
SYEGIELDLKYLEKVLPYLHQLWGRTVHMESIVESKGVVFSYDGKMVHRKYV
Download sequence
Identical sequences A0A0F6FVK4 A0A243GXN4 A0A2C0K4F3 R8N8D5 R8QL61
WP_001202700.1.10845 WP_001202700.1.1112 WP_001202700.1.18749 WP_001202700.1.19516 WP_001202700.1.2206 WP_001202700.1.27106 WP_001202700.1.29836 WP_001202700.1.29993 WP_001202700.1.34175 WP_001202700.1.34587 WP_001202700.1.37239 WP_001202700.1.38427 WP_001202700.1.38591 WP_001202700.1.4185 WP_001202700.1.41879 WP_001202700.1.42167 WP_001202700.1.42218 WP_001202700.1.43767 WP_001202700.1.44497 WP_001202700.1.49455 WP_001202700.1.49702 WP_001202700.1.50694 WP_001202700.1.51047 WP_001202700.1.54777 WP_001202700.1.5543 WP_001202700.1.58632 WP_001202700.1.63743 WP_001202700.1.64764 WP_001202700.1.674 WP_001202700.1.6743 WP_001202700.1.68007 WP_001202700.1.68346 WP_001202700.1.69501 WP_001202700.1.70181 WP_001202700.1.74372 WP_001202700.1.74832 WP_001202700.1.74857 WP_001202700.1.74976 WP_001202700.1.76883 WP_001202700.1.77386 WP_001202700.1.81000 WP_001202700.1.83694 WP_001202700.1.85928 WP_001202700.1.87013 WP_001202700.1.87725 WP_001202700.1.89009 WP_001202700.1.90665 WP_001202700.1.9860 gi|449087560|ref|YP_007420001.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]