SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F6G0N1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0F6G0N1
Domain Number - Region: 37-167
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.000209
Family SMI1/KNR4-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0F6G0N1
Sequence length 171
Comment (tr|A0A0F6G0N1|A0A0F6G0N1_BACTK) Syd family protein {ECO:0000313|EMBL:AJK44158.1} KW=Complete proteome OX=29339 OS=Bacillus thuringiensis subsp. kurstaki. GN=BG08_2557 OC=Bacillus cereus group.
Sequence
MSKYFNLRKEYFDKGLDFLFKTPYNEEVDSFIYQGEMDDEEEISWKPIEKNNKNDLTKIE
ERFEIKLHTSIDDYFNSYWFADLDGFIGNHYIRLEPVLPNIELDSFESNLEGYKNNHNKV
DKTPIGVEGNGLIVVLDNVSGKVELEDFERGSFEEISDSLDELIASLKLQK
Download sequence
Identical sequences A0A0F6G0N1 A0A1E8B659 R8E0R8 R8M0Y1 R8Q140 R8QEQ2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]