SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F6H8Q4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0F6H8Q4
Domain Number - Region: 198-255
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.0251
Family Regulator of G-protein signaling, RGS 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0F6H8Q4
Sequence length 314
Comment (tr|A0A0F6H8Q4|A0A0F6H8Q4_LEPIR) Nucleotidyl transferase, PF08843 family {ECO:0000313|EMBL:EKO24636.1} KW=Complete proteome OX=1049937 OS=Leptospira interrogans str. UI 12621. GN=LEP1GSC104_2086 OC=Bacteria; Spirochaetes; Leptospirales; Leptospiraceae; Leptospira.
Sequence
MIKPFIHEDKNWKELIQIVSDSKKILPTLIEKDYWIMHTLWSLSNSGLSYFMKGGTSLSK
AYRVIDRFSEDIDLLIEDESLRSQTARKDTSPKNVEKRKKFFDGLTTRIQVPGAVNIERN
KDFDSDHLINAGIVVSYNSSNQVEGVKSGILLEIGFDTVEPWEEKNISSWIIDYLEKTEQ
LKDFFDNRALSVRCYRPEYTFVEKLQAISTKYRQLAEGLDISNFARHYYDVYKLLELPNI
QKFIGSEKYIEHKNNRFRSKDEKNLTKNDAFILNNPNMFKQIEDRYEKTKAIYYGKVPRL
QEIIESLKPHLSKM
Download sequence
Identical sequences A0A0F6H8Q4 M6FR98 M6LH13
WP_000594907.1.20778 WP_000594907.1.26477 WP_000594907.1.31926 WP_000594907.1.382 WP_000594907.1.49027 WP_000594907.1.54177 WP_000594907.1.5862 WP_000594907.1.67421 WP_000594907.1.68993 WP_000594907.1.69136 WP_000594907.1.74792 WP_000594907.1.7707 WP_000594907.1.79939 WP_000594907.1.82265 WP_000594907.1.90761

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]