SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F6HC30 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0F6HC30
Domain Number - Region: 13-43
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0294
Family SMI1/KNR4-like 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0F6HC30
Sequence length 70
Comment (tr|A0A0F6HC30|A0A0F6HC30_LEPIR) Uncharacterized protein {ECO:0000313|EMBL:EKO25857.1} KW=Complete proteome OX=1049937 OS=Leptospira interrogans str. UI 12621. GN=LEP1GSC104_0823 OC=Bacteria; Spirochaetes; Leptospirales; Leptospiraceae; Leptospira.
Sequence
MVINYFKIKPLDITESELDEYEKYIGFPLYNEDKEAILKYNGFRKALAIRKRLKLSSLEN
ISSSDLLNKE
Download sequence
Identical sequences A0A0F6HC30
WP_002105555.1.31321 WP_002105555.1.74792 WP_002105555.1.7707 WP_002105555.1.79939

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]