SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F6J5K0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0F6J5K0
Domain Number - Region: 25-90
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.0965
Family Regulator of G-protein signaling, RGS 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0F6J5K0
Sequence length 111
Comment (tr|A0A0F6J5K0|A0A0F6J5K0_BACTU) Uncharacterized protein {ECO:0000313|EMBL:ERH99932.1} KW=Complete proteome OX=1324966 OS=Bacillus thuringiensis T01-328. GN=BTCBT_003907 OC=Bacillus cereus group.
Sequence
MRSRRYKRGDRVKINIHKSVSPEMLAWLNKQSNPTNFFFFAAQQLFKQVGDIDVSKALPS
SHVFSLYVEPSSLLKVEVNPFKNMTLEANTSTENAKKKLWESVDQLDCPFF
Download sequence
Identical sequences A0A0D0QI63 A0A0F6J5K0 A0A0K0QE62 A0A1C9BUF8 A0A1I4JFM2 A0A1M6X967 A0A1Q9I2X1 A0A243ESH6 A0A243FWK1 A0A243KAM6 A0A243KF17 A0A243LED3 A0A2A2P7T3 A0A2A9I1B0 J8IH93 J8R6G5 J9BNI5 M1QGD5 R8DUV1 R8FKX1 R8FVK2 R8GG04 R8K8N7 S3IDZ1
gi|384186802|ref|YP_005572698.1| gi|452199163|ref|YP_007479244.1| WP_001257761.1.11442 WP_001257761.1.11521 WP_001257761.1.13279 WP_001257761.1.14174 WP_001257761.1.17374 WP_001257761.1.22152 WP_001257761.1.22699 WP_001257761.1.25290 WP_001257761.1.28237 WP_001257761.1.3249 WP_001257761.1.33717 WP_001257761.1.33790 WP_001257761.1.34061 WP_001257761.1.34125 WP_001257761.1.38345 WP_001257761.1.3925 WP_001257761.1.40818 WP_001257761.1.41729 WP_001257761.1.46326 WP_001257761.1.54547 WP_001257761.1.57561 WP_001257761.1.5895 WP_001257761.1.60255 WP_001257761.1.62277 WP_001257761.1.69347 WP_001257761.1.70108 WP_001257761.1.71652 WP_001257761.1.72752 WP_001257761.1.74651 WP_001257761.1.7534 WP_001257761.1.75891 WP_001257761.1.75942 WP_001257761.1.76155 WP_001257761.1.77402 WP_001257761.1.79549 WP_001257761.1.80622 WP_001257761.1.84541 WP_001257761.1.84614 WP_001257761.1.85667 WP_001257761.1.8577 WP_001257761.1.86763 WP_001257761.1.88154 WP_001257761.1.90452 WP_001257761.1.91020 WP_001257761.1.91367 WP_001257761.1.93838 WP_001257761.1.94914 WP_001257761.1.9533 WP_001257761.1.96272 WP_001257761.1.97262 WP_001257761.1.98604

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]