SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F6JFZ6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F6JFZ6
Domain Number 1 Region: 19-163
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.000000000000275
Family SMI1/KNR4-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0F6JFZ6
Sequence length 172
Comment (tr|A0A0F6JFZ6|A0A0F6JFZ6_BACTU) SMI1 / KNR4 family protein {ECO:0000313|EMBL:ERI03579.1} KW=Complete proteome OX=1324966 OS=Bacillus thuringiensis T01-328. GN=BTCBT_000776 OC=Bacillus cereus group.
Sequence
MNNWKDKIATMILVKQELMKQDVEKIWPHHFPEVGANEKSIRIIEQELGYKLDLMYREFL
QYANGWAVFYQTVDLFGTEQLKESAIMDYAQVLLEAIDDVVLEESGVLRQELLPIAVSEF
DRDLFVLCLPNSSRPGEIIWFAGEEIDRFENFDEYFLVMIDYNREEILALKG
Download sequence
Identical sequences A0A0F6JFZ6 A0A1W6WS70 M1QRL4
gi|410676512|ref|YP_006928883.1| gi|452200581|ref|YP_007480662.1| WP_001067165.1.23360 WP_001067165.1.33790 WP_001067165.1.57561 WP_001067165.1.5895 WP_001067165.1.62277 WP_001067165.1.71652 WP_001067165.1.80622 WP_001067165.1.84541 WP_001067165.1.8577 WP_001067165.1.91020 gi|384188192|ref|YP_005574088.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]