SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F6LIU5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F6LIU5
Domain Number 1 Region: 5-122
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.000000667
Family SMI1/KNR4-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0F6LIU5
Sequence length 123
Comment (tr|A0A0F6LIU5|A0A0F6LIU5_VIBPH) Uncharacterized protein {ECO:0000313|EMBL:KIS73544.1} KW=Complete proteome OX=1288784 OS=Vibrio parahaemolyticus 863. GN=H325_07525 OC=Vibrionaceae; Vibrio.
Sequence
MISLSDIENLIQHIWEEPIFSDVTSKKVVVSLYGTLSKKIPDKFIIIEEVFPKDELEDIW
SNYEEYLDEYLIFPFLGTLGEAVICIGYGNDNKGKIFYFDFDFGACELDGDNLEAFLEKL
LES
Download sequence
Identical sequences A0A0F6LIU5 A0A0L8UU71 Q87PI4 Z2EQA6
gi|28898292|ref|NP_797897.1| NP_797897.1.6614 WP_005479433.1.101585 WP_005479433.1.10999 WP_005479433.1.14243 WP_005479433.1.15211 WP_005479433.1.15563 WP_005479433.1.16073 WP_005479433.1.16503 WP_005479433.1.16742 WP_005479433.1.1836 WP_005479433.1.19074 WP_005479433.1.19755 WP_005479433.1.20587 WP_005479433.1.21130 WP_005479433.1.22008 WP_005479433.1.22854 WP_005479433.1.22951 WP_005479433.1.24866 WP_005479433.1.25390 WP_005479433.1.26080 WP_005479433.1.26245 WP_005479433.1.264 WP_005479433.1.27000 WP_005479433.1.29928 WP_005479433.1.31998 WP_005479433.1.35596 WP_005479433.1.35751 WP_005479433.1.36788 WP_005479433.1.37683 WP_005479433.1.39 WP_005479433.1.39142 WP_005479433.1.39379 WP_005479433.1.3961 WP_005479433.1.39756 WP_005479433.1.39842 WP_005479433.1.42776 WP_005479433.1.42858 WP_005479433.1.43895 WP_005479433.1.45633 WP_005479433.1.46057 WP_005479433.1.4734 WP_005479433.1.47510 WP_005479433.1.48035 WP_005479433.1.4861 WP_005479433.1.48612 WP_005479433.1.4902 WP_005479433.1.49432 WP_005479433.1.49920 WP_005479433.1.5033 WP_005479433.1.50640 WP_005479433.1.50833 WP_005479433.1.51945 WP_005479433.1.52959 WP_005479433.1.53064 WP_005479433.1.53207 WP_005479433.1.53702 WP_005479433.1.53943 WP_005479433.1.54059 WP_005479433.1.55108 WP_005479433.1.55354 WP_005479433.1.5595 WP_005479433.1.56068 WP_005479433.1.56836 WP_005479433.1.56842 WP_005479433.1.57129 WP_005479433.1.57332 WP_005479433.1.5768 WP_005479433.1.58791 WP_005479433.1.5962 WP_005479433.1.59786 WP_005479433.1.59887 WP_005479433.1.60089 WP_005479433.1.60172 WP_005479433.1.606 WP_005479433.1.61129 WP_005479433.1.61745 WP_005479433.1.62401 WP_005479433.1.6274 WP_005479433.1.63316 WP_005479433.1.6404 WP_005479433.1.65279 WP_005479433.1.66211 WP_005479433.1.66850 WP_005479433.1.71278 WP_005479433.1.71997 WP_005479433.1.73712 WP_005479433.1.74603 WP_005479433.1.74813 WP_005479433.1.75461 WP_005479433.1.75707 WP_005479433.1.79694 WP_005479433.1.81752 WP_005479433.1.81782 WP_005479433.1.81805 WP_005479433.1.81887 WP_005479433.1.82387 WP_005479433.1.82791 WP_005479433.1.84036 WP_005479433.1.86416 WP_005479433.1.86700 WP_005479433.1.88312 WP_005479433.1.90588 WP_005479433.1.91910 WP_005479433.1.92596 WP_005479433.1.92678 WP_005479433.1.92816 WP_005479433.1.93458 WP_005479433.1.94697 WP_005479433.1.96264 WP_005479433.1.9642 WP_005479433.1.96491 WP_005479433.1.98178 WP_005479433.1.99805 223926.VP1518

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]