SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F6MJN3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0F6MJN3
Domain Number - Region: 159-217
Classification Level Classification E-value
Superfamily R1 subunit of ribonucleotide reductase, N-terminal domain 0.0217
Family R1 subunit of ribonucleotide reductase, N-terminal domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0F6MJN3
Sequence length 246
Comment (tr|A0A0F6MJN3|A0A0F6MJN3_SHIFL) Uncharacterized protein {ECO:0000313|EMBL:EID64379.1} KW=Complete proteome OX=1086030 OS=Shigella flexneri 5a str. M90T. GN=SF5M90T_4075 OC=Enterobacteriaceae; Shigella.
Sequence
MFLIEQINDLKMWVNKYTDDCTDEDLNDRDFIASVVDRAIFHFAINSICNPGDNKDAMPI
EQCTFDVETKNGLPSTVQLFYEESKDNEPLANIHFQAIGSGFLTFVNACQEHDDNSLKLF
ASLLISLSYSSAYADLSETVYINENNESYLKAQFEKLYQRDMKKYLGEMKRLADGGEMNF
DGYLDKMSHLVNEGTLDPDILSKMRDAAPQLISFAKSFDPTSKEEIKILTDTSKLIYDLF
GVKSEK
Download sequence
Identical sequences A0A0F6MJN3 Q0SXR5
gi|110807935|ref|YP_691455.1| 373384.SFV_4165

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]