SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F6MMT7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F6MMT7
Domain Number 1 Region: 33-85,120-193
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 3.27e-20
Family SMI1/KNR4-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0F6MMT7
Sequence length 195
Comment (tr|A0A0F6MMT7|A0A0F6MMT7_TREDN) Uncharacterized protein {ECO:0000313|EMBL:EMB20211.1} KW=Complete proteome OX=999434 OS=Treponema denticola OTK. GN=HMPREF9723_01671 OC=Bacteria; Spirochaetes; Spirochaetales; Spirochaetaceae; Treponema.
Sequence
MQLIDKIKEIEKYICEHFEEWDLDDPVEEGYLDDYQEISGASEEEISAFEKKFGITLPED
FKELYRYKNGSKYLSIFPCVIDEIEMPFNLMSLQTVTKTKEHFQNRDALLSEFTDYFTNE
DIENMKDSRIKPYLFNKKWIPFAEYCDSCFLMLDFDPDTTGKEGQIICYIHDPDKVVYAA
PSITELVDGIIAEID
Download sequence
Identical sequences A0A0F6MMT7 M2SK30
WP_002676884.1.15337 WP_002676884.1.18616 WP_002676884.1.74579

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]