SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F6U0G5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F6U0G5
Domain Number 1 Region: 4-132
Classification Level Classification E-value
Superfamily PapD-like 4.91e-44
Family Pilus chaperone 0.00024
Further Details:      
 
Domain Number 2 Region: 126-226
Classification Level Classification E-value
Superfamily Periplasmic chaperone C-domain 1.09e-17
Family Periplasmic chaperone C-domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0F6U0G5
Sequence length 234
Comment (tr|A0A0F6U0G5|A0A0F6U0G5_CITAM) Fimbrial assembly protein {ECO:0000313|EMBL:AKE62002.1} KW=Complete proteome OX=1261127 OS=Citrobacter amalonaticus Y19. GN=F384_19925 OC=Enterobacteriaceae; Citrobacter.
Sequence
MFSLNVMADVVINGTRIVFNAKDKESTVQLKNRGSNPYLLQIWMDDGNPRAKPGEVSVPF
LITPPVVRIDPAKGQAVRIMATNPALPQDRESVFWFNMLEIPPKAQAATSGNTRMQLAFR
TRIKLFYRPDNLQPTPLQSYKELKLSLQGNNVKVVNDSPYYITFNKIEIRKTKESDVLAS
VENFSQRMVNPKSEIVFPLANKKSARLNDASFFYSVINDYGGETTNEHKLQNSP
Download sequence
Identical sequences A0A0F6U0G5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]