SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F6U6C6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0F6U6C6
Domain Number - Region: 66-105
Classification Level Classification E-value
Superfamily Nucleotidyltransferase substrate binding subunit/domain 0.0243
Family Family 1 bi-partite nucleotidyltransferase subunit 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0F6U6C6
Sequence length 113
Comment (tr|A0A0F6U6C6|A0A0F6U6C6_MICAE) Uncharacterized protein {ECO:0000313|EMBL:AKE65534.1} KW=Complete proteome OX=1641812 OS=Microcystis aeruginosa NIES-2549. GN=MYAER_3196 OC=Microcystaceae; Microcystis.
Sequence
MWRDKAFLLDIVRAGQLAQQFAEQLDRELLESDLRTQSAILYQITIMGEATKRLSPGFRK
QHPEIPWDDIAGMRDIIAHQYDRIDLDIVWQVIRRNIPELLNLLIPLLPTQDT
Download sequence
Identical sequences A0A0F6U6C6 A0A1E4QFP9 A0A2H6BLR5 I4FH07 I4GEA9 I4HAM0 I4HIB1 L7EE79
WP_002734383.1.13945 WP_002734383.1.15998 WP_002734383.1.39664 WP_002734383.1.42333 WP_002734383.1.50673 WP_002734383.1.5315 WP_002734383.1.77316 WP_002734383.1.92877 WP_002734383.1.98808

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]