SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F6VX31 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F6VX31
Domain Number 1 Region: 6-162
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 1.18e-19
Family SMI1/KNR4-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0F6VX31
Sequence length 173
Comment (tr|A0A0F6VX31|A0A0F6VX31_CROSK) Uncharacterized protein {ECO:0000313|EMBL:AKE97374.1} KW=Complete proteome OX=28141 OS=Cronobacter sakazakii (Enterobacter sakazakii). GN=CSK29544_1p0055 OC=Enterobacteriaceae; Cronobacter.
Sequence
MPVSCGKMITEADIQRLEKTYCISLPEDYKTFLLLNNGFVVKSPDYCNLAYGGVDEGAIA
FNALFGIGTKNEYYDIEYNNEELFSELDFIDSKLIIGDDPGGNYYLMLNGEHQQGLFYWD
RTHLHAEDTLQDFEIPEQNECGNLYRLSDSFTQFYQSVIDNTLAQGMQVTRDL
Download sequence
Identical sequences A0A0F6VX31
WP_007896834.1.17179 WP_007896834.1.22032 WP_007896834.1.23247 WP_007896834.1.25078 WP_007896834.1.29215 WP_007896834.1.44053 WP_007896834.1.48540 WP_007896834.1.69840 WP_007896834.1.72434 WP_007896834.1.82482 WP_007896834.1.86965 WP_007896834.1.89683 WP_007896834.1.93704

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]