SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F6W249 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F6W249
Domain Number 1 Region: 63-161
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000000916
Family SMI1/KNR4-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0F6W249
Sequence length 197
Comment (tr|A0A0F6W249|A0A0F6W249_9DELT) Uncharacterized protein {ECO:0000313|EMBL:AKF05473.1} KW=Complete proteome; Reference proteome OX=927083 OS=Sandaracinus amylolyticus. GN=DB32_002622 OC=Sorangiineae; Sandaracinaceae; Sandaracinus.
Sequence
MQAGERIEALTRRWIAAGKNVYVAKEPPFDPDDGGVPPAMWDGEPDPSGWVRWRATEPRV
APGDLQRVEERIGAKLPPLVRAWLSTSSIGPLESERLRLPALWSDSPLRDLESLLDAWSP
LERAGFVVIGEDGNDAGPLCIDLAARDEWGDARVVAFDHEALIALGPVACARREMVAPLA
QARFSSFAALLDALDRS
Download sequence
Identical sequences A0A0F6W249
WP_053232709.1.70751

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]